Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069
• Artikelnummer: LS-C497069-20
• Hersteller Artikelnummer: LS-C497069-20
• Alternativnummer: LS-C497069-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2). IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
• Konjugation: Unconjugated
• Alternative Synonym: HNRNPLL, HnRNPLL, HNRPLL, SRRF, Stromal RNA regulating factor, Stromal RNA-regulating factor

Produktbeschreibung

HNRPLL antibody LS-C497069 is an unconjugated rabbit polyclonal antibody to HNRPLL (HnRNPLL) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 92906
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 30kDa/31kDa/56kDa/59kDa/60kDa, while the observed MW by Western blot was 60kDa.