Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069

Product Overview

• Article Name: Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069
• Biozol Catalog Number: LS-C497069-20
• Supplier Catalog Number: LS-C497069-20
• Alternative Catalog Number: LS-C497069-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2). IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
• Conjugation: Unconjugated
• Alternative Names: HNRNPLL, HnRNPLL, HNRPLL, SRRF, Stromal RNA regulating factor, Stromal RNA-regulating factor

Product Description

HNRPLL antibody LS-C497069 is an unconjugated rabbit polyclonal antibody to HNRPLL (HnRNPLL) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 92906
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 30kDa/31kDa/56kDa/59kDa/60kDa, while the observed MW by Western blot was 60kDa.