Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121

Artikelnummer: LS-C497121-100
Artikelname: Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121
Artikelnummer: LS-C497121-100
Hersteller Artikelnummer: LS-C497121-100
Alternativnummer: LS-C497121-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-340 of human SLC39A14 (NP_001128626.1). ILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMI
Konjugation: Unconjugated
Alternative Synonym: SLC39A14, KIAA0062, LZT-Hs4, NET34, Zrt-, Irt-like protein 14, Zinc transporter ZIP14, ZIP-14, ZIP14, Zrt- and Irt-like protein 14, Cig19
ZIP14 antibody LS-C497121 is an unconjugated rabbit polyclonal antibody to human ZIP14 (SLC39A14). Validated for WB.
Klonalität: Polyclonal
Konzentration: 4.17 mg/ml
NCBI: 23516
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 52kDa/54kDa, while the observed MW by Western blot was 50kDa.