Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121

Product Overview

• Article Name: Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121
• Biozol Catalog Number: LS-C497121-100
• Supplier Catalog Number: LS-C497121-100
• Alternative Catalog Number: LS-C497121-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-340 of human SLC39A14 (NP_001128626.1). ILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMI
• Conjugation: Unconjugated
• Alternative Names: SLC39A14, KIAA0062, LZT-Hs4, NET34, Zrt-, Irt-like protein 14, Zinc transporter ZIP14, ZIP-14, ZIP14, Zrt- and Irt-like protein 14, Cig19

Product Description

ZIP14 antibody LS-C497121 is an unconjugated rabbit polyclonal antibody to human ZIP14 (SLC39A14). Validated for WB.

Product Properties

• Clonality: Polyclonal
• Concentration: 4.17 mg/ml
• NCBI: 23516
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 52kDa/54kDa, while the observed MW by Western blot was 50kDa.