Polyclonal Rabbit anti-Human ALDH3B1 Antibody (WB) LS-C497123

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human ALDH3B1 Antibody (WB) LS-C497123
• Artikelnummer: LS-C497123-100
• Hersteller Artikelnummer: LS-C497123-100
• Alternativnummer: LS-C497123-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1). MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYP
• Konjugation: Unconjugated
• Alternative Synonym: ALDH3B1, Aldehyde dehydrogenase 3B1, Aldehyde dehydrogenase 7, ALDH7, ALDH4

Produktbeschreibung

ALDH3B1 antibody LS-C497123 is an unconjugated rabbit polyclonal antibody to ALDH3B1 from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 221
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 47kDa/51kDa, while the observed MW by Western blot was 52kDa.