Polyclonal Rabbit anti-Human ALDH3B1 Antibody (WB) LS-C497123

Catalog Number: LS-C497123-100
Article Name: Polyclonal Rabbit anti-Human ALDH3B1 Antibody (WB) LS-C497123
Biozol Catalog Number: LS-C497123-100
Supplier Catalog Number: LS-C497123-100
Alternative Catalog Number: LS-C497123-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1). MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYP
Conjugation: Unconjugated
Alternative Names: ALDH3B1, Aldehyde dehydrogenase 3B1, Aldehyde dehydrogenase 7, ALDH7, ALDH4
ALDH3B1 antibody LS-C497123 is an unconjugated rabbit polyclonal antibody to ALDH3B1 from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 221
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 47kDa/51kDa, while the observed MW by Western blot was 52kDa.