TNFAIP6 / TSG-6 Antibody LS-C661862, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TNFAIP6 / TSG-6 Antibody LS-C661862, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C661862-10
• Hersteller Artikelnummer: LS-C661862-10
• Alternativnummer: LS-C661862-10
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human TSG6 (46-91 aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: TNFAIP6, Hyaluronate-binding protein, TNF-stimulated gene 6 protein, TSG-6, TNF alpha-induced protein 6, TSG6

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 7130
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB

Bilder

Western blot - Anti-TSG6 Antibody