TNFAIP6 / TSG-6 Antibody LS-C661862, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C661862-10
Article Name: TNFAIP6 / TSG-6 Antibody LS-C661862, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C661862-10
Supplier Catalog Number: LS-C661862-10
Alternative Catalog Number: LS-C661862-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human TSG6 (46-91 aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
Conjugation: Unconjugated
Alternative Names: TNFAIP6, Hyaluronate-binding protein, TNF-stimulated gene 6 protein, TSG-6, TNF alpha-induced protein 6, TSG6
Clonality: Polyclonal
NCBI: 7130
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Application Notes: WB
Western blot - Anti-TSG6 Antibody