Polyclonal Rabbit anti-Human TNFAIP6 / TSG-6 Antibody (WB) LS-C661862

Artikelnummer: LS-C661862-100
Artikelname: Polyclonal Rabbit anti-Human TNFAIP6 / TSG-6 Antibody (WB) LS-C661862
Artikelnummer: LS-C661862-100
Hersteller Artikelnummer: LS-C661862-100
Alternativnummer: LS-C661862-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human TSG6 (46-91 aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
Konjugation: Unconjugated
Alternative Synonym: TNFAIP6, Hyaluronate-binding protein, TNF-stimulated gene 6 protein, TSG-6, TNF alpha-induced protein 6, TSG6
TSG-6 antibody LS-C661862 is an unconjugated rabbit polyclonal antibody to human TSG-6 (TNFAIP6). Validated for WB.
Klonalität: Polyclonal
NCBI: 7130
Puffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reinheit: Immunogen affinity purified
Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Application Verdünnung: WB
Anwendungsbeschreibung: WB
Western blot - Anti-TSG6 Antibody