Polyclonal Rabbit anti-Human TNFAIP6 / TSG-6 Antibody (WB) LS-C661862

Product Overview

• Article Name: Polyclonal Rabbit anti-Human TNFAIP6 / TSG-6 Antibody (WB) LS-C661862
• Biozol Catalog Number: LS-C661862-100
• Supplier Catalog Number: LS-C661862-100
• Alternative Catalog Number: LS-C661862-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human TSG6 (46-91 aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
• Conjugation: Unconjugated
• Alternative Names: TNFAIP6, Hyaluronate-binding protein, TNF-stimulated gene 6 protein, TSG-6, TNF alpha-induced protein 6, TSG6

Product Description

TSG-6 antibody LS-C661862 is an unconjugated rabbit polyclonal antibody to human TSG-6 (TNFAIP6). Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 7130
• Buffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Purity: Immunogen affinity purified
• Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Application Notes

• Application Dilute: WB
• Application Notes: WB

Images

Western blot - Anti-TSG6 Antibody