MMP11 Antibody LS-C661865, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: MMP11 Antibody LS-C661865, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C661865-10
• Hersteller Artikelnummer: LS-C661865-10
• Alternativnummer: LS-C661865-10
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP11 (104-135 aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: MMP11, SL-3, Stromelysin III, Matrix metalloproteinase-11, MMP-11, ST3, STMY3, Stromelysin-3

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 4320
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Anwendungsbeschreibung

• Anwendungsbeschreibung: IHC, IHC-P, WB

Bilder

Western blot - Anti-MMP11 Picoband Antibody