MMP11 Antibody LS-C661865, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C661865-10
Article Name: MMP11 Antibody LS-C661865, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C661865-10
Supplier Catalog Number: LS-C661865-10
Alternative Catalog Number: LS-C661865-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP11 (104-135 aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
Conjugation: Unconjugated
Alternative Names: MMP11, SL-3, Stromelysin III, Matrix metalloproteinase-11, MMP-11, ST3, STMY3, Stromelysin-3
Clonality: Polyclonal
NCBI: 4320
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Application Notes: IHC, IHC-P, WB
Western blot - Anti-MMP11 Picoband Antibody