Polyclonal Rabbit anti-Human MMP11 Antibody (IHC, WB) LS-C661865

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human MMP11 Antibody (IHC, WB) LS-C661865
• Artikelnummer: LS-C661865-100
• Hersteller Artikelnummer: LS-C661865-100
• Alternativnummer: LS-C661865-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP11 (104-135 aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: MMP11, SL-3, Stromelysin III, Matrix metalloproteinase-11, MMP-11, ST3, STMY3, Stromelysin-3

Produktbeschreibung

MMP11 antibody LS-C661865 is an unconjugated rabbit polyclonal antibody to human MMP11. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 4320
• Puffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Anwendungsbeschreibung

• Application Verdünnung: IHC, IHC-P, WB
• Anwendungsbeschreibung: IHC, IHC-P, WB

Bilder

Western blot - Anti-MMP11 Picoband Antibody