Polyclonal Rabbit anti-Human MMP11 Antibody (IHC, WB) LS-C661865

Product Overview

• Article Name: Polyclonal Rabbit anti-Human MMP11 Antibody (IHC, WB) LS-C661865
• Biozol Catalog Number: LS-C661865-100
• Supplier Catalog Number: LS-C661865-100
• Alternative Catalog Number: LS-C661865-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC, IHC-P, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP11 (104-135 aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Conjugation: Unconjugated
• Alternative Names: MMP11, SL-3, Stromelysin III, Matrix metalloproteinase-11, MMP-11, ST3, STMY3, Stromelysin-3

Product Description

MMP11 antibody LS-C661865 is an unconjugated rabbit polyclonal antibody to human MMP11. Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 4320
• Buffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Purity: Immunogen affinity purified
• Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Application Notes

• Application Dilute: IHC, IHC-P, WB
• Application Notes: IHC, IHC-P, WB

Images

Western blot - Anti-MMP11 Picoband Antibody