CD119 / IFNGR1 Antibody LS-C661879, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: CD119 / IFNGR1 Antibody LS-C661879, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C661879-10
• Hersteller Artikelnummer: LS-C661879-10
• Alternativnummer: LS-C661879-10
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 3459
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Anwendungsbeschreibung

• Anwendungsbeschreibung: Flo, ICC, IHC, WB

Bilder

Western blot - Anti-IFNGR1/Cd119 Picoband Antibody