CD119 / IFNGR1 Antibody LS-C661879, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: CD119 / IFNGR1 Antibody LS-C661879, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: LS-C661879-10
• Supplier Catalog Number: LS-C661879-10
• Alternative Catalog Number: LS-C661879-10
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
• Conjugation: Unconjugated
• Alternative Names: IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119

Product Properties

• Clonality: Polyclonal
• NCBI: 3459
• Purity: Immunogen affinity purified
• Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Application Notes

• Application Notes: Flo, ICC, IHC, WB

Images

Western blot - Anti-IFNGR1/Cd119 Picoband Antibody