Polyclonal Rabbit anti-Human CD119 / IFNGR1 Antibody (IHC, WB) LS-C661879

Artikelnummer: LS-C661879-100
Artikelname: Polyclonal Rabbit anti-Human CD119 / IFNGR1 Antibody (IHC, WB) LS-C661879
Artikelnummer: LS-C661879-100
Hersteller Artikelnummer: LS-C661879-100
Alternativnummer: LS-C661879-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
Konjugation: Unconjugated
Alternative Synonym: IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119
IFNGR1 antibody LS-C661879 is an unconjugated rabbit polyclonal antibody to human IFNGR1 (CD119). Validated for Flow, ICC, IHC and WB.
Klonalität: Polyclonal
NCBI: 3459
Puffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reinheit: Immunogen affinity purified
Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Application Verdünnung: Flo, ICC, IHC, WB
Anwendungsbeschreibung: Flo, ICC, IHC, WB
Western blot - Anti-IFNGR1/Cd119 Picoband Antibody