Polyclonal Rabbit anti-Human CD119 / IFNGR1 Antibody (IHC, WB) LS-C661879

Product Overview

• Article Name: Polyclonal Rabbit anti-Human CD119 / IFNGR1 Antibody (IHC, WB) LS-C661879
• Biozol Catalog Number: LS-C661879-100
• Supplier Catalog Number: LS-C661879-100
• Alternative Catalog Number: LS-C661879-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: FC, ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
• Conjugation: Unconjugated
• Alternative Names: IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119

Product Description

IFNGR1 antibody LS-C661879 is an unconjugated rabbit polyclonal antibody to human IFNGR1 (CD119). Validated for Flow, ICC, IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 3459
• Buffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Purity: Immunogen affinity purified
• Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Application Notes

• Application Dilute: Flo, ICC, IHC, WB
• Application Notes: Flo, ICC, IHC, WB

Images

Western blot - Anti-IFNGR1/Cd119 Picoband Antibody