Polyclonal Rabbit anti-Human EPCAM Antibody (IHC, WB) LS-C661885

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human EPCAM Antibody (IHC, WB) LS-C661885
• Artikelnummer: LS-C661885-100
• Hersteller Artikelnummer: LS-C661885-100
• Alternativnummer: LS-C661885-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, FC, ICC, IHC, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen a
• Konjugation: Unconjugated
• Alternative Synonym: EPCAM, 323/A3, ACSTD1, 17-1A, CD326, EGP, EGP34, Epithelial glycoprotein, GA733-2, HNPCC8, Ep-CAM, ESA, HEGP314, KS 1/4 antigen, KS1/4, KSA, M1S2, MIC18, MK-1, MH99, TROP1, TACST-1, TACSTD1, CD326 antigen, CO-17A, DIAR5, EGP-2, EGP314, EGP40, Epithelial

Produktbeschreibung

EPCAM antibody LS-C661885 is an unconjugated rabbit polyclonal antibody to human EPCAM. Validated for ELISA, Flow, ICC, IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 4072
• Puffer: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: ELISA, Flo, ICC, IHC, IHC-P, WB
• Anwendungsbeschreibung: ELISA, Flo, ICC, IHC, IHC-P, WB

Bilder

Western blot analysis of EPCAM expression in HELA whole cell lysates, A549 whole cell lysates and P