Polyclonal Rabbit anti-Human EPCAM Antibody (IHC, WB) LS-C661885
Catalog Number:
LS-C661885-100
- Images (1)
| Article Name: | Polyclonal Rabbit anti-Human EPCAM Antibody (IHC, WB) LS-C661885 |
| Biozol Catalog Number: | LS-C661885-100 |
| Supplier Catalog Number: | LS-C661885-100 |
| Alternative Catalog Number: | LS-C661885-100 |
| Manufacturer: | LifeSpan Biosciences |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, FC, ICC, IHC, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen a |
| Conjugation: | Unconjugated |
| Alternative Names: | EPCAM, 323/A3, ACSTD1, 17-1A, CD326, EGP, EGP34, Epithelial glycoprotein, GA733-2, HNPCC8, Ep-CAM, ESA, HEGP314, KS 1/4 antigen, KS1/4, KSA, M1S2, MIC18, MK-1, MH99, TROP1, TACST-1, TACSTD1, CD326 antigen, CO-17A, DIAR5, EGP-2, EGP314, EGP40, Epithelial |
| EPCAM antibody LS-C661885 is an unconjugated rabbit polyclonal antibody to human EPCAM. Validated for ELISA, Flow, ICC, IHC and WB. |
| Clonality: | Polyclonal |
| NCBI: | 4072 |
| Buffer: | Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide. |
| Purity: | Immunogen affinity purified |
| Form: | Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide. |
| Application Dilute: | ELISA, Flo, ICC, IHC, IHC-P, WB |
| Application Notes: | ELISA, Flo, ICC, IHC, IHC-P, WB |
|
|
Western blot analysis of EPCAM expression in HELA whole cell lysates, A549 whole cell lysates and P |
Product Guarantee and Expert Support
