Polyclonal Rabbit anti-Human GAA / Alpha-Glucosidase, Acid Antibody (IHC, WB) LS-C661892

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human GAA / Alpha-Glucosidase, Acid Antibody (IHC, WB) LS-C661892
• Artikelnummer: LS-C661892-100
• Hersteller Artikelnummer: LS-C661892-100
• Alternativnummer: LS-C661892-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527 aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: GAA, Acid maltase, Aglucosidase alfa, Glucosidase, alpha, Lysosomal alpha-glucosidase, Glucosidase, alpha acid, LYAG

Produktbeschreibung

Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated rabbit polyclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 2548
• Puffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Anwendungsbeschreibung

• Application Verdünnung: IHC, WB
• Anwendungsbeschreibung: IHC, WB

Bilder

Western blot analysis of GAA expr