Polyclonal Rabbit anti-Human GAA / Alpha-Glucosidase, Acid Antibody (IHC, WB) LS-C661892

Product Overview

• Article Name: Polyclonal Rabbit anti-Human GAA / Alpha-Glucosidase, Acid Antibody (IHC, WB) LS-C661892
• Biozol Catalog Number: LS-C661892-100
• Supplier Catalog Number: LS-C661892-100
• Alternative Catalog Number: LS-C661892-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527 aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
• Conjugation: Unconjugated
• Alternative Names: GAA, Acid maltase, Aglucosidase alfa, Glucosidase, alpha, Lysosomal alpha-glucosidase, Glucosidase, alpha acid, LYAG

Product Description

Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated rabbit polyclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 2548
• Buffer: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
• Purity: Immunogen affinity purified
• Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Application Notes

• Application Dilute: IHC, WB
• Application Notes: IHC, WB

Images

Western blot analysis of GAA expr