PVRL4 / Nectin 4 Antibody LS-C662971, Unconjugated, Rabbit, Polyclonal

Artikelnummer: LS-C662971-10
Artikelname: PVRL4 / Nectin 4 Antibody LS-C662971, Unconjugated, Rabbit, Polyclonal
Artikelnummer: LS-C662971-10
Hersteller Artikelnummer: LS-C662971-10
Alternativnummer: LS-C662971-10
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Nectin-4/PVRL4 (53-94 aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
Konjugation: Unconjugated
Alternative Synonym: PVRL4, EDSS1, Nectin 4, Ig superfamily receptor LNIR, Poliovirus receptor-like 4, LNIR, Nectin-4, Poliovirus receptor-related 4
Klonalität: Polyclonal
NCBI: 81607
Reinheit: Immunogen affinity purified
Formulierung: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Anwendungsbeschreibung: WB