PVRL4 / Nectin 4 Antibody LS-C662971, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C662971-10
Article Name: PVRL4 / Nectin 4 Antibody LS-C662971, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C662971-10
Supplier Catalog Number: LS-C662971-10
Alternative Catalog Number: LS-C662971-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Nectin-4/PVRL4 (53-94 aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
Conjugation: Unconjugated
Alternative Names: PVRL4, EDSS1, Nectin 4, Ig superfamily receptor LNIR, Poliovirus receptor-like 4, LNIR, Nectin-4, Poliovirus receptor-related 4
Clonality: Polyclonal
NCBI: 81607
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Application Notes: WB