Polyclonal Rabbit anti-Human ACKR3 / CXCR7 Antibody (WB) LS-C747794

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human ACKR3 / CXCR7 Antibody (WB) LS-C747794
• Artikelnummer: LS-C747794-20
• Hersteller Artikelnummer: LS-C747794-20
• Alternativnummer: LS-C747794-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACKR3 (NP_064707.1). IYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT
• Konjugation: Unconjugated
• Alternative Synonym: ACKR3, Chemokine orphan receptor 1, CMKOR1, CXCR7, CXC-R7, GPRN1, RDC1, RDC-1, CXCR-7, G-protein coupled receptor 159, GPR159

Produktbeschreibung

CXCR7 antibody LS-C747794 is an unconjugated rabbit polyclonal antibody to CXCR7 (ACKR3) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 57007
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 41kDa, while the observed MW by Western blot was 55kDa.