Polyclonal Rabbit anti-Human ACKR3 / CXCR7 Antibody (WB) LS-C747794

Product Overview

• Article Name: Polyclonal Rabbit anti-Human ACKR3 / CXCR7 Antibody (WB) LS-C747794
• Biozol Catalog Number: LS-C747794-20
• Supplier Catalog Number: LS-C747794-20
• Alternative Catalog Number: LS-C747794-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACKR3 (NP_064707.1). IYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT
• Conjugation: Unconjugated
• Alternative Names: ACKR3, Chemokine orphan receptor 1, CMKOR1, CXCR7, CXC-R7, GPRN1, RDC1, RDC-1, CXCR-7, G-protein coupled receptor 159, GPR159

Product Description

CXCR7 antibody LS-C747794 is an unconjugated rabbit polyclonal antibody to CXCR7 (ACKR3) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 57007
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 41kDa, while the observed MW by Western blot was 55kDa.