Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799
• Artikelnummer: LS-C747799-20
• Hersteller Artikelnummer: LS-C747799-20
• Alternativnummer: LS-C747799-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL
• Konjugation: Unconjugated
• Alternative Synonym: LHX9, LIM homeobox 9, LIM homeobox protein 9, LIM/homeobox protein Lhx9

Produktbeschreibung

LHX9 antibody LS-C747799 is an unconjugated rabbit polyclonal antibody to LHX9 from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 56956
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 36kDa/37kDa/42kDa/43kDa, while the observed MW by Western blot was 54kDa.