Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799

Artikelnummer: LS-C747799-20
Artikelname: Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799
Artikelnummer: LS-C747799-20
Hersteller Artikelnummer: LS-C747799-20
Alternativnummer: LS-C747799-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL
Konjugation: Unconjugated
Alternative Synonym: LHX9, LIM homeobox 9, LIM homeobox protein 9, LIM/homeobox protein Lhx9
LHX9 antibody LS-C747799 is an unconjugated rabbit polyclonal antibody to LHX9 from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 56956
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 36kDa/37kDa/42kDa/43kDa, while the observed MW by Western blot was 54kDa.