Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL
Conjugation:
Unconjugated
Alternative Names:
LHX9, LIM homeobox 9, LIM homeobox protein 9, LIM/homeobox protein Lhx9
LHX9 antibody LS-C747799 is an unconjugated rabbit polyclonal antibody to LHX9 from human. It is reactive with human, mouse and rat. Validated for WB.