Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Konjugation:
Unconjugated
Alternative Synonym:
MAF, C-MAF, CCA4, C-maf proto-oncogene, Proto-oncogene c-Maf, T lymphocyte c-maf long form, Transcription factor Maf
C-Maf antibody LS-C747804 is an unconjugated rabbit polyclonal antibody to c-Maf from human. It is reactive with human, mouse and rat. Validated for WB.