Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804
• Artikelnummer: LS-C747804-100
• Hersteller Artikelnummer: LS-C747804-100
• Alternativnummer: LS-C747804-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
• Konjugation: Unconjugated
• Alternative Synonym: MAF, C-MAF, CCA4, C-maf proto-oncogene, Proto-oncogene c-Maf, T lymphocyte c-maf long form, Transcription factor Maf

Produktbeschreibung

C-Maf antibody LS-C747804 is an unconjugated rabbit polyclonal antibody to c-Maf from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 4094
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:1000 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 38kDa/41kDa, while the observed MW by Western blot was 38kDa.