Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804

Product Overview

• Article Name: Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804
• Biozol Catalog Number: LS-C747804-100
• Supplier Catalog Number: LS-C747804-100
• Alternative Catalog Number: LS-C747804-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
• Conjugation: Unconjugated
• Alternative Names: MAF, C-MAF, CCA4, C-maf proto-oncogene, Proto-oncogene c-Maf, T lymphocyte c-maf long form, Transcription factor Maf

Product Description

C-Maf antibody LS-C747804 is an unconjugated rabbit polyclonal antibody to c-Maf from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 4094
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:1000 - 1:2000)
• Application Notes: The predicted MW is 38kDa/41kDa, while the observed MW by Western blot was 38kDa.