Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806
• Artikelnummer: LS-C749806-100
• Hersteller Artikelnummer: LS-C749806-100
• Alternativnummer: LS-C749806-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1). MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
• Konjugation: Unconjugated
• Alternative Synonym: SLC4A8, K-NBC3, KIAA0739, KNBC3, NBC3, NDCBE, NDCBE1, Nbc-3, NBC

Produktbeschreibung

NBC antibody LS-C749806 is an unconjugated rabbit polyclonal antibody to NBC (SLC4A8) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 9498
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 71kDa/77kDa/83kDa/111kDa/117kDa/120kDa/122kDa, while the observed MW by Western blot was 123kDa.