Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806

Product Overview

• Article Name: Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806
• Biozol Catalog Number: LS-C749806-100
• Supplier Catalog Number: LS-C749806-100
• Alternative Catalog Number: LS-C749806-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1). MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
• Conjugation: Unconjugated
• Alternative Names: SLC4A8, K-NBC3, KIAA0739, KNBC3, NBC3, NDCBE, NDCBE1, Nbc-3, NBC

Product Description

NBC antibody LS-C749806 is an unconjugated rabbit polyclonal antibody to NBC (SLC4A8) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 9498
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 71kDa/77kDa/83kDa/111kDa/117kDa/120kDa/122kDa, while the observed MW by Western blot was 123kDa.