Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842
• Artikelnummer: LS-C749842-100
• Hersteller Artikelnummer: LS-C749842-100
• Alternativnummer: LS-C749842-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2). LFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNF
• Konjugation: Unconjugated
• Alternative Synonym: SLC7A8, HLAT2, LPI-PC1, Integral membrane protein E16H

Produktbeschreibung

LAT2 antibody LS-C749842 is an unconjugated rabbit polyclonal antibody to human LAT2 (SLC7A8). Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 23428
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 34kDa/37kDa/48kDa/58kDa, while the observed MW by Western blot was 58kDa.