Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842

Product Overview

• Article Name: Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842
• Biozol Catalog Number: LS-C749842-100
• Supplier Catalog Number: LS-C749842-100
• Alternative Catalog Number: LS-C749842-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2). LFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNF
• Conjugation: Unconjugated
• Alternative Names: SLC7A8, HLAT2, LPI-PC1, Integral membrane protein E16H

Product Description

LAT2 antibody LS-C749842 is an unconjugated rabbit polyclonal antibody to human LAT2 (SLC7A8). Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 23428
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 34kDa/37kDa/48kDa/58kDa, while the observed MW by Western blot was 58kDa.