Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750138

Artikelnummer: LS-C750138-20
Artikelname: Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750138
Artikelnummer: LS-C750138-20
Hersteller Artikelnummer: LS-C750138-20
Alternativnummer: LS-C750138-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDT
Konjugation: Unconjugated
Alternative Synonym: RNF125, RING finger protein 125, TRAC-1, TRAC1
TRAC-1 antibody LS-C750138 is an unconjugated rabbit polyclonal antibody to TRAC-1 (RNF125) from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 54941
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 26kDa, while the observed MW by Western blot was 29kDa.