Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750138

Product Overview

• Article Name: Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750138
• Biozol Catalog Number: LS-C750138-20
• Supplier Catalog Number: LS-C750138-20
• Alternative Catalog Number: LS-C750138-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDT
• Conjugation: Unconjugated
• Alternative Names: RNF125, RING finger protein 125, TRAC-1, TRAC1

Product Description

TRAC-1 antibody LS-C750138 is an unconjugated rabbit polyclonal antibody to TRAC-1 (RNF125) from human. It is reactive with human and mouse. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 54941
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 26kDa, while the observed MW by Western blot was 29kDa.