Polyclonal Rabbit anti-Human CNNM2 Antibody (WB) LS-C750139

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human CNNM2 Antibody (WB) LS-C750139
• Artikelnummer: LS-C750139-100
• Hersteller Artikelnummer: LS-C750139-100
• Alternativnummer: LS-C750139-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CNNM2 (NP_060119.3). PLLLLSCCCGAGGCAAVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGERGLGGPAPPEPDSGPQRC
• Konjugation: Unconjugated
• Alternative Synonym: CNNM2, ACDP2, Cyclin M2, Cyclin-M2, Metal transporter CNNM2

Produktbeschreibung

CNNM2 antibody LS-C750139 is an unconjugated rabbit polyclonal antibody to human CNNM2. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 2.93 mg/ml
• NCBI: 54805
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 60kDa/94kDa/96kDa.