Polyclonal Rabbit anti-Human CNNM2 Antibody (WB) LS-C750139

Product Overview

• Article Name: Polyclonal Rabbit anti-Human CNNM2 Antibody (WB) LS-C750139
• Biozol Catalog Number: LS-C750139-100
• Supplier Catalog Number: LS-C750139-100
• Alternative Catalog Number: LS-C750139-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CNNM2 (NP_060119.3). PLLLLSCCCGAGGCAAVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGERGLGGPAPPEPDSGPQRC
• Conjugation: Unconjugated
• Alternative Names: CNNM2, ACDP2, Cyclin M2, Cyclin-M2, Metal transporter CNNM2

Product Description

CNNM2 antibody LS-C750139 is an unconjugated rabbit polyclonal antibody to human CNNM2. Validated for WB.

Product Properties

• Clonality: Polyclonal
• Concentration: 2.93 mg/ml
• NCBI: 54805
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 60kDa/94kDa/96kDa.