Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142
• Artikelnummer: LS-C750142-20
• Hersteller Artikelnummer: LS-C750142-20
• Alternativnummer: LS-C750142-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-Terminus of human PSENEN (NP_758844.1). LGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
• Konjugation: Unconjugated
• Alternative Synonym: PSENEN, Gamma-secretase subunit PEN-2, MSTP064, Presenilin enhancer protein 2, MDS033, PEN-2, PEN2

Produktbeschreibung

PEN-2 antibody LS-C750142 is an unconjugated rabbit polyclonal antibody to PEN-2 (PSENEN) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 55851
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 12kDa, while the observed MW by Western blot was 16kDa.