Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142

Catalog Number: LS-C750142-20
Article Name: Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142
Biozol Catalog Number: LS-C750142-20
Supplier Catalog Number: LS-C750142-20
Alternative Catalog Number: LS-C750142-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-Terminus of human PSENEN (NP_758844.1). LGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Conjugation: Unconjugated
Alternative Names: PSENEN, Gamma-secretase subunit PEN-2, MSTP064, Presenilin enhancer protein 2, MDS033, PEN-2, PEN2
PEN-2 antibody LS-C750142 is an unconjugated rabbit polyclonal antibody to PEN-2 (PSENEN) from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 55851
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 12kDa, while the observed MW by Western blot was 16kDa.