Polyclonal Rabbit anti-Human AICDA / AID Antibody (Biotin, IHC) LS-C761216

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human AICDA / AID Antibody (Biotin, IHC) LS-C761216
• Artikelnummer: LS-C761216-100
• Hersteller Artikelnummer: LS-C761216-100
• Alternativnummer: LS-C761216-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC
• Spezies Reaktivität: Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
• Konjugation: Biotin
• Alternative Synonym: AICDA, AID, ARP2, CDA2, Cytidine aminohydrolase, HIGM2

Produktbeschreibung

AID antibody LS-C761216 is a biotin-conjugated rabbit polyclonal antibody to AID (AICDA) from human. It is reactive with human, mouse, rat and other species. Validated for IHC.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 57379
• Puffer: PBS, 0.09% sodium azide, 2% sucrose
• Reinheit: Affinity purified
• Formulierung: PBS, 0.09% sodium azide, 2% sucrose

Anwendungsbeschreibung

• Application Verdünnung: IHC
• Anwendungsbeschreibung: Applications should be user optimized.