Polyclonal Rabbit anti-Human AICDA / AID Antibody (Biotin, IHC) LS-C761216

Product Overview

• Article Name: Polyclonal Rabbit anti-Human AICDA / AID Antibody (Biotin, IHC) LS-C761216
• Biozol Catalog Number: LS-C761216-100
• Supplier Catalog Number: LS-C761216-100
• Alternative Catalog Number: LS-C761216-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
• Conjugation: Biotin
• Alternative Names: AICDA, AID, ARP2, CDA2, Cytidine aminohydrolase, HIGM2

Product Description

AID antibody LS-C761216 is a biotin-conjugated rabbit polyclonal antibody to AID (AICDA) from human. It is reactive with human, mouse, rat and other species. Validated for IHC.

Product Properties

• Clonality: Polyclonal
• NCBI: 57379
• Buffer: PBS, 0.09% sodium azide, 2% sucrose
• Purity: Affinity purified
• Form: PBS, 0.09% sodium azide, 2% sucrose

Application Notes

• Application Dilute: IHC
• Application Notes: Applications should be user optimized.