Polyclonal Rabbit anti-Human RHCG Antibody (Biotin, IHC, WB) LS-C761221

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human RHCG Antibody (Biotin, IHC, WB) LS-C761221
• Artikelnummer: LS-C761221-100
• Hersteller Artikelnummer: LS-C761221-100
• Alternativnummer: LS-C761221-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL
• Konjugation: Biotin
• Alternative Synonym: RHCG, Ammonium transporter Rh type C, C15orf6, CDRC2, Rh family, C glycoprotein, RHGK, SLC42A3, Tumor-related protein DRC2, Rh family type C glycoprotein, Rh type C glycoprotein, PDRC2, Rh glycoprotein kidney

Produktbeschreibung

RHCG antibody LS-C761221 is a biotin-conjugated rabbit polyclonal antibody to human RHCG. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 51458
• Puffer: PBS, 0.09% sodium azide, 2% sucrose
• Reinheit: Affinity purified
• Formulierung: PBS, 0.09% sodium azide, 2% sucrose

Anwendungsbeschreibung

• Application Verdünnung: IHC, WB
• Anwendungsbeschreibung: Applications should be user optimized.