Polyclonal Rabbit anti-Human RHCG Antibody (Biotin, IHC, WB) LS-C761221

Product Overview

• Article Name: Polyclonal Rabbit anti-Human RHCG Antibody (Biotin, IHC, WB) LS-C761221
• Biozol Catalog Number: LS-C761221-100
• Supplier Catalog Number: LS-C761221-100
• Alternative Catalog Number: LS-C761221-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL
• Conjugation: Biotin
• Alternative Names: RHCG, Ammonium transporter Rh type C, C15orf6, CDRC2, Rh family, C glycoprotein, RHGK, SLC42A3, Tumor-related protein DRC2, Rh family type C glycoprotein, Rh type C glycoprotein, PDRC2, Rh glycoprotein kidney

Product Description

RHCG antibody LS-C761221 is a biotin-conjugated rabbit polyclonal antibody to human RHCG. Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 51458
• Buffer: PBS, 0.09% sodium azide, 2% sucrose
• Purity: Affinity purified
• Form: PBS, 0.09% sodium azide, 2% sucrose

Application Notes

• Application Dilute: IHC, WB
• Application Notes: Applications should be user optimized.