Polyclonal Rabbit anti-Human TECTA Antibody (IHC, WB) LS-C782771

Artikelnummer: LS-C782771-100
Artikelname: Polyclonal Rabbit anti-Human TECTA Antibody (IHC, WB) LS-C782771
Artikelnummer: LS-C782771-100
Hersteller Artikelnummer: LS-C782771-100
Alternativnummer: LS-C782771-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.
Konjugation: Unconjugated
Alternative Synonym: TECTA, Alpha-tectorin, DFNB21, DFNA12, Tectorin alpha, DFNA8
TECTA antibody LS-C782771 is an unconjugated rabbit polyclonal antibody to TECTA from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 7007
Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reinheit: Antigen Affinity purification
Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Verdünnung: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
Anwendungsbeschreibung: Optimal dilution of the TECTA antibody should be determined by the researcher.