Polyclonal Rabbit anti-Human TECTA Antibody (IHC, WB) LS-C782771

Catalog Number: LS-C782771-100
Article Name: Polyclonal Rabbit anti-Human TECTA Antibody (IHC, WB) LS-C782771
Biozol Catalog Number: LS-C782771-100
Supplier Catalog Number: LS-C782771-100
Alternative Catalog Number: LS-C782771-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.
Conjugation: Unconjugated
Alternative Names: TECTA, Alpha-tectorin, DFNB21, DFNA12, Tectorin alpha, DFNA8
TECTA antibody LS-C782771 is an unconjugated rabbit polyclonal antibody to TECTA from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 7007
Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Purity: Antigen Affinity purification
Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Dilute: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
Application Notes: Optimal dilution of the TECTA antibody should be determined by the researcher.