Polyclonal Rabbit anti-Mouse ANXA4 / Annexin IV Antibody (WB) LS-C782778

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Mouse ANXA4 / Annexin IV Antibody (WB) LS-C782778
• Artikelnummer: LS-C782778-100
• Hersteller Artikelnummer: LS-C782778-100
• Alternativnummer: LS-C782778-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody.
• Konjugation: Unconjugated
• Alternative Synonym: ANXA4, 35-beta calcimedin, ANX4, Annexin A4, Annexin IV, Annexin-4, Chromobindin-4, Endonexin I, Lipocortin IV, p32.5, PIG28, Proliferation-inducing gene 28, Protein II, ZAP36, p33/41, PAP-II, PP4-X

Produktbeschreibung

Annexin IV antibody LS-C782778 is an unconjugated rabbit polyclonal antibody to Annexin IV (ANXA4) from mouse. It is reactive with mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 307
• Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
• Reinheit: Antigen Affinity purification
• Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: WB (0.5 - 1 µg/ml)
• Anwendungsbeschreibung: Optimal dilution of the Annexin IV antibody should be determined by the researcher.