Polyclonal Rabbit anti-Mouse ANXA4 / Annexin IV Antibody (WB) LS-C782778

Product Overview

• Article Name: Polyclonal Rabbit anti-Mouse ANXA4 / Annexin IV Antibody (WB) LS-C782778
• Biozol Catalog Number: LS-C782778-100
• Supplier Catalog Number: LS-C782778-100
• Alternative Catalog Number: LS-C782778-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse, Rat
• Immunogen: Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody.
• Conjugation: Unconjugated
• Alternative Names: ANXA4, 35-beta calcimedin, ANX4, Annexin A4, Annexin IV, Annexin-4, Chromobindin-4, Endonexin I, Lipocortin IV, p32.5, PIG28, Proliferation-inducing gene 28, Protein II, ZAP36, p33/41, PAP-II, PP4-X

Product Description

Annexin IV antibody LS-C782778 is an unconjugated rabbit polyclonal antibody to Annexin IV (ANXA4) from mouse. It is reactive with mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 307
• Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
• Purity: Antigen Affinity purification
• Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Application Notes

• Application Dilute: WB (0.5 - 1 µg/ml)
• Application Notes: Optimal dilution of the Annexin IV antibody should be determined by the researcher.