Polyclonal Rabbit anti-Human ANXA8 / Annexin A8 Antibody (WB) LS-C782781
Artikelnummer:
LS-C782781-100
| Artikelname: |
Polyclonal Rabbit anti-Human ANXA8 / Annexin A8 Antibody (WB) LS-C782781 |
| Artikelnummer: |
LS-C782781-100 |
| Hersteller Artikelnummer: |
LS-C782781-100 |
| Alternativnummer: |
LS-C782781-100 |
| Hersteller: |
LifeSpan Biosciences |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ANXA8, Annexin A8, Annexin-8, ANX8, Vascular anticoagulant-beta, Annexin VIII, VAC-beta |
| Annexin A8 antibody LS-C782781 is an unconjugated rabbit polyclonal antibody to human Annexin A8 (ANXA8). Validated for WB. |
| Klonalität: |
Polyclonal |
| NCBI: |
653145 |
| Puffer: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Reinheit: |
Antigen Affinity purification |
| Formulierung: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Verdünnung: |
WB (0.5 - 1 µg/ml) |
| Anwendungsbeschreibung: |
Optimal dilution of the Annexin VIII antibody should be determined by the researcher. |
