Polyclonal Rabbit anti-Human ANXA8 / Annexin A8 Antibody (WB) LS-C782781
Catalog Number:
LS-C782781-100
| Article Name: |
Polyclonal Rabbit anti-Human ANXA8 / Annexin A8 Antibody (WB) LS-C782781 |
| Biozol Catalog Number: |
LS-C782781-100 |
| Supplier Catalog Number: |
LS-C782781-100 |
| Alternative Catalog Number: |
LS-C782781-100 |
| Manufacturer: |
LifeSpan Biosciences |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ANXA8, Annexin A8, Annexin-8, ANX8, Vascular anticoagulant-beta, Annexin VIII, VAC-beta |
| Annexin A8 antibody LS-C782781 is an unconjugated rabbit polyclonal antibody to human Annexin A8 (ANXA8). Validated for WB. |
| Clonality: |
Polyclonal |
| NCBI: |
653145 |
| Buffer: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Purity: |
Antigen Affinity purification |
| Form: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Dilute: |
WB (0.5 - 1 µg/ml) |
| Application Notes: |
Optimal dilution of the Annexin VIII antibody should be determined by the researcher. |
